Antibodies

Jump to Filters
View as table Download
SELS (SELENOS) Rabbit Polyclonal Antibody
TA346517

USD 475.00

5 Days

Rabbit Polyclonal Anti-SELS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SELS antibody: synthetic peptide directed towards the middle region of human SELS. Synthetic peptide located within the following region: PDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDS
SELS (SELENOS) Rabbit Polyclonal Antibody
TA322291

USD 345.00

In Stock

Anti-VIMP Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 98-112 amino acids of human VCP-interacting membrane protein
SELS (SELENOS) Rabbit Polyclonal Antibody
TA322292

USD 345.00

In Stock

Anti-VIMP Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 98-112 amino acids of human VCP-interacting membrane protein