Rabbit Polyclonal Anti-SEMG2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SEMG2 antibody: synthetic peptide directed towards the N terminal of human SEMG2. Synthetic peptide located within the following region: GQKGQHYFGQKDQQHTKSKGSFSIQHTYHVDINDHDWTRKSQQYDLNALH |
SEMG2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 383-582 of human SEMG2 (NP_002999.1). |
| Modifications | Unmodified |
SEMG2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 383-582 of human SEMG2 (NP_002999.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China