Rabbit Polyclonal Anti-SEPT11 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SEPT11(septin 11) antibody: synthetic peptide directed towards the N terminal of human SEPT11(septin 11). Synthetic peptide located within the following region: MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGET |
Septin 11 (SEPT11) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 352-382 amino acids from the Central region of Human SEPT11 |
Septin 11 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Septin 11 (NP_060713.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
