Rabbit Polyclonal Anti-SEPT2 Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SEPT2 antibody: synthetic peptide directed towards the N terminal of human SEPT2. Synthetic peptide located within the following region: MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK |
Rabbit anti-SEPT2 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SEPT2 |
Rabbit Polyclonal Anti-SEPT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SEPT2 antibody: synthetic peptide directed towards the middle region of human SEPT2. Synthetic peptide located within the following region: LQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMI |
Rabbit polyclonal anti-SEPT2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SEPT2. |
Septin 2 (SEPT2) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 279-309 amino acids from the C-terminal region of Human SEPT2 |
Goat Anti-SEPT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence SKQQPTQFINPET-C, from the N terminus of the protein sequence according to NP_001008491.1. |
Rabbit Polyclonal Anti-SEPT2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
SEPTIN2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SEPTIN2 |
Germany
Japan
United Kingdom
China
