Antibodies

Jump to Filters
View as table Download
SEPT6 Rabbit Polyclonal Antibody
TA312371

USD 345.00

In Stock

Rabbit polyclonal anti-SEPT6 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SEPT6.
SEPT6 Goat Polyclonal Antibody
TA305718

USD 375.00

5 Days

Goat Anti-SEPT6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DEVNAFKQRKTA, from the internal region of the protein sequence according to NP_665798.1; NP_055944.2; NP_665801.1.
SEPT6 Rabbit Polyclonal Antibody
TA339322

USD 310.00

5 Days

Rabbit Polyclonal Anti-SEPT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEPT6(septin 6) antibody: synthetic peptide directed towards the middle region of human SEPT6(septin 6). Synthetic peptide located within the following region: CKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVQRV
SEPT6 Rabbit Polyclonal Antibody
TA339323

USD 375.00

5 Days

Rabbit Polyclonal Anti-SEPT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEPT6(septin 6) antibody: synthetic peptide directed towards the N terminal of human SEPT6(septin 6). Synthetic peptide located within the following region: TGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIV
SEPT6 Goat Polyclonal Antibody
TA355091

USD 375.00

5 Days

Goat Anti-SEPT6, Biotinylated Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is expected to recognize the reported isoforms NP_665798.1, NP_055944.2 and NP_665801.1