Antibodies

Jump to Filters
View as table Download
alpha 1 Antichymotrypsin (SERPINA3) Rabbit Polyclonal Antibody
TA332391

USD 275.00

3 Weeks

Rabbit anti-SERPINA3 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human SERPINA3
alpha 1 Antichymotrypsin (SERPINA3) Goat Polyclonal Antibody
TA326743

USD 375.00

5 Days

Goat Anti-alpha-1-antichymotrypsin (aa222-236) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DPQDTHQSRFYLSKK, from the internal region of the protein sequence according to NP_001076.2.
alpha 1 Antichymotrypsin (SERPINA3) Rabbit Polyclonal Antibody
TA339986

USD 375.00

5 Days

Rabbit Polyclonal Anti-SERPINA3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINA3 antibody: synthetic peptide directed towards the middle region of human SERPINA3. Synthetic peptide located within the following region: FRDEELSCTVVELKYTGNASALFILPDQDKMEEVEAMLLPETLKRWRDSL
alpha 1 Antichymotrypsin (SERPINA3) Rabbit Polyclonal Antibody
TA323305

USD 345.00

4 Weeks

Anti-SERPINA3 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 3
alpha 1 Antichymotrypsin (SERPINA3) Rabbit Polyclonal Antibody
TA323306

USD 345.00

In Stock

Anti-SERPINA3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 3
alpha 1 Antichymotrypsin (SERPINA3) Rabbit Polyclonal Antibody
TA323307

USD 345.00

4 Weeks

Anti-AACT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 290-303 amino acids of Human Alpha-1-antichymotrypsin
alpha 1 Antichymotrypsin (SERPINA3) Rabbit Polyclonal Antibody
TA381370

USD 220.00

3 Weeks

Alpha-1 Antichymotrypsin (SERPINA3) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 24-423 of human Alpha-1 Antichymotrypsin (Alpha-1 Antichymotrypsin (SERPINA3)) (NP_001076.2).
Modifications Unmodified