Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 36 of 36 results

(reset)

SERPINB1 Rabbit Polyclonal Antibody

TA340203

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-SERPINB1 Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-SERPINB1 antibody: synthetic peptide directed towards the middle region of human SERPINB1. Synthetic peptide located within the following region: RVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENL

SERPINB1 (Center) Rabbit Polyclonal Antibody

AP53861PU-N

USD 450.00

2 Weeks

SERPINB1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications	WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 167-196 amino acids from the Central region of Human SERPINB1 (NP_109591.1)

SERPINB1 Goat Polyclonal Antibody

TA327770

USD 375.00

5 Days

SERPINB1 Goat Polyclonal Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	internal region (EVHSRFQSLNADINKR)

SERPINB1 Goat Polyclonal Antibody

TA327771

USD 375.00

5 Days

SERPINB1 Goat Polyclonal Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	internal region (KTINQWVKGQTEGK)

SERPINB1 Mouse Monoclonal Antibody [Clone ID: OTI4B3]

CF800076

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SERPINB1 mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)

Applications	FC, IHC, WB
Reactivities	Human, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

SERPINB1 Mouse Monoclonal Antibody [Clone ID: OTI1D1]

CF800077

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SERPINB1 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Dog
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SERPINB1 Mouse Monoclonal Antibody [Clone ID: OTI2B4]

CF800078

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SERPINB1 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)

Applications	FC, IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

SERPINB1 Mouse Monoclonal Antibody [Clone ID: OTI3B4]

CF800093

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SERPINB1 mouse monoclonal antibody, clone OTI3B4 (formerly 3B4)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

SERPINB1 Mouse Monoclonal Antibody [Clone ID: OTI2D11]

CF800094

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SERPINB1 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications	WB
Reactivities	Human, Monkey, Dog
Conjugation	Unconjugated

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

SERPINB1 Mouse Monoclonal Antibody [Clone ID: OTI2B10]

CF800117

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SERPINB1 mouse monoclonal antibody, clone OTI2B10 (formerly 2B10)

Applications	WB
Reactivities	Human, Monkey, Dog
Conjugation	Unconjugated

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

SERPINB1 Rabbit Polyclonal Antibody

TA350405

USD 345.00

In Stock

Rabbit Polyclonal Anti-SERPINB1 rabbit polyclonal antibody

Applications	IHC
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human SERPINB1

SERPINB1 Rabbit Polyclonal Antibody

TA381377

USD 220.00

3 Weeks

SERPINB1 Rabbit polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 100-379 of human SERPINB1 (NP_109591.1).
Modifications	Unmodified

SERPINB1 Mouse Monoclonal Antibody [Clone ID: OTI4B3]

TA800076

USD 379.00

In Stock

SERPINB1 mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)

Applications	FC, IHC, WB
Reactivities	Human, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

SERPINB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B3]

TA800076AM

USD 420.00

5 Days

SERPINB1 mouse monoclonal antibody,clone 4B3, Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Rat, Dog
Conjugation	Biotin

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

SERPINB1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B3]

TA800076BM

USD 420.00

5 Days

SERPINB1 mouse monoclonal antibody,clone 4B3, HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Rat, Dog
Conjugation	HRP

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

SERPINB1 Mouse Monoclonal Antibody [Clone ID: OTI4B3]

TA800076S

USD 159.00

2 Days

SERPINB1 mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)

Applications	FC, IHC, WB
Reactivities	Human, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

SERPINB1 Mouse Monoclonal Antibody [Clone ID: OTI1D1]

TA800077

USD 379.00

In Stock

SERPINB1 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Dog
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SERPINB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D1]

TA800077AM

USD 420.00

5 Days

SERPINB1 mouse monoclonal antibody,clone 1D1, Biotinylated

Applications	FC, IF, WB
Reactivities	Human, Monkey, Dog
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SERPINB1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D1]

TA800077BM

USD 420.00

5 Days

SERPINB1 mouse monoclonal antibody,clone 1D1, HRP conjugated

Applications	FC, IF, WB
Reactivities	Human, Monkey, Dog
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SERPINB1 Mouse Monoclonal Antibody [Clone ID: OTI1D1]

TA800077S

USD 159.00

2 Days

SERPINB1 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Dog
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

SERPINB1 Mouse Monoclonal Antibody [Clone ID: OTI2B4]

TA800078

USD 379.00

In Stock

SERPINB1 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)

Applications	FC, IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

SERPINB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B4]

TA800078AM

USD 420.00

5 Days

SERPINB1 mouse monoclonal antibody,clone 2B4, Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Monkey
Conjugation	Biotin

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

SERPINB1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B4]

TA800078BM

USD 420.00

5 Days

SERPINB1 mouse monoclonal antibody,clone 2B4, HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Monkey
Conjugation	HRP

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

SERPINB1 Mouse Monoclonal Antibody [Clone ID: OTI2B4]

TA800078S

USD 159.00

2 Days

SERPINB1 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)

Applications	FC, IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

SERPINB1 Mouse Monoclonal Antibody [Clone ID: OTI3B4]

TA800093

USD 379.00

In Stock

SERPINB1 mouse monoclonal antibody, clone OTI3B4 (formerly 3B4)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Special Offer: Get a 15% discount on this product. Use code: "KO15".

SERPINB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B4]

TA800093AM

USD 420.00

5 Days

SERPINB1 mouse monoclonal antibody,clone 3B4, Biotinylated

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Biotin

• 
• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

SERPINB1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B4]

TA800093BM

USD 420.00

5 Days

SERPINB1 mouse monoclonal antibody,clone 3B4, HRP conjugated

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	HRP

• 
• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

SERPINB1 Mouse Monoclonal Antibody [Clone ID: OTI3B4]

TA800093S

USD 159.00

In Stock

SERPINB1 mouse monoclonal antibody, clone OTI3B4 (formerly 3B4)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

SERPINB1 Mouse Monoclonal Antibody [Clone ID: OTI2D11]

TA800094

USD 379.00

In Stock

SERPINB1 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications	WB
Reactivities	Human, Monkey, Dog
Conjugation	Unconjugated

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

Special Offer: Get a 15% discount on this product. Use code: "KO15".

SERPINB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D11]

TA800094AM

USD 420.00

5 Days

SERPINB1 mouse monoclonal antibody,clone 2D11, Biotinylated

Applications	WB
Reactivities	Human, Monkey, Dog
Conjugation	Biotin

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

SERPINB1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D11]

TA800094BM

USD 420.00

5 Days

SERPINB1 mouse monoclonal antibody,clone 2D11, HRP conjugated

Applications	WB
Reactivities	Human, Monkey, Dog
Conjugation	HRP

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

SERPINB1 Mouse Monoclonal Antibody [Clone ID: OTI2D11]

TA800094S

USD 159.00

2 Days

SERPINB1 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications	WB
Reactivities	Human, Monkey, Dog
Conjugation	Unconjugated

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

SERPINB1 Mouse Monoclonal Antibody [Clone ID: OTI2B10]

TA800117

USD 379.00

In Stock

SERPINB1 mouse monoclonal antibody, clone OTI2B10 (formerly 2B10)

Applications	WB
Reactivities	Human, Monkey, Dog
Conjugation	Unconjugated

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

Special Offer: Get a 15% discount on this product. Use code: "KO15".

SERPINB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B10]

TA800117AM

USD 420.00

5 Days

SERPINB1 mouse monoclonal antibody,clone 2B10, Biotinylated

Applications	WB
Reactivities	Human, Monkey, Dog
Conjugation	Biotin

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

SERPINB1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B10]

TA800117BM

USD 420.00

5 Days

SERPINB1 mouse monoclonal antibody,clone 2B10, HRP conjugated

Applications	WB
Reactivities	Human, Monkey, Dog
Conjugation	HRP

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

SERPINB1 Mouse Monoclonal Antibody [Clone ID: OTI2B10]

TA800117S

USD 159.00

2 Days

SERPINB1 mouse monoclonal antibody, clone OTI2B10 (formerly 2B10)

Applications	WB
Reactivities	Human, Monkey, Dog
Conjugation	Unconjugated

• 
• 

1 / 3

2 / 3

3 / 3

Previous Next

1 - 36 of 36 results