Antibodies

View as table Download

Rabbit Polyclonal Anti-SERPINB13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINB13 antibody: synthetic peptide directed towards the N terminal of human SERPINB13. Synthetic peptide located within the following region: RLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNAADESRKKINSWVESKT

Carrier-free (BSA/glycerol-free) SERPINB13 mouse monoclonal antibody, clone OTI2B6 (formerly 2B6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINB13 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINB13 mouse monoclonal antibody, clone OTI1B12 (formerly 1B12)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINB13 mouse monoclonal antibody, clone OTI1A7 (formerly 1A7)

Applications FC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINB13 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)

Applications FC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

SERPINB13 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human SERPINB13 (NP_036529.1).
Modifications Unmodified

SERPINB13 mouse monoclonal antibody, clone OTI2B6 (formerly 2B6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB13 mouse monoclonal antibody, clone OTI2B6 (formerly 2B6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB13 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB13 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB13 mouse monoclonal antibody, clone OTI1B12 (formerly 1B12)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB13 mouse monoclonal antibody, clone OTI1B12 (formerly 1B12)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB13 mouse monoclonal antibody, clone OTI1A7 (formerly 1A7)

Applications FC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

SERPINB13 mouse monoclonal antibody, clone OTI1A7 (formerly 1A7)

Applications FC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

SERPINB13 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)

Applications FC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

SERPINB13 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)

Applications FC, WB
Reactivities Human, Mouse
Conjugation Unconjugated