Antibodies

View as table Download

Rabbit Polyclonal Anti-SERPINB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINB4 antibody: synthetic peptide directed towards the N terminal of human SERPINB4. Synthetic peptide located within the following region: TSALGMVLLGAKDNTAQQISKVLHFDQVTENTTEKAATYHVDRSGNVHHQ

Rabbit Polyclonal SERPINB4 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit polyclonal anti-SERPINB4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SERPINB4.

SERPINB4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 275-304aa) of human SERPINB4 / SCCA2

Carrier-free (BSA/glycerol-free) SERPINB4 mouse monoclonal antibody, clone OTI2B9 (formerly 2B9)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINB4 mouse monoclonal antibody, clone OTI2H8 (formerly 2H8)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINB4 mouse monoclonal antibody, clone OTI3C5 (formerly 3C5)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINB4 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINB4 mouse monoclonal antibody, clone OTI4C8 (formerly 4C8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINB4 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINB4 mouse monoclonal antibody, clone OTI4C10 (formerly 4C10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB4 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SERPINB4

SERPINB4 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human SERPINB4 (NP_002965.1).
Modifications Unmodified

SERPINB4 mouse monoclonal antibody, clone OTI2B9 (formerly 2B9)

Applications WB
Reactivities Human
Conjugation Unconjugated

SERPINB4 mouse monoclonal antibody, clone OTI2B9 (formerly 2B9), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

SERPINB4 mouse monoclonal antibody, clone OTI2B9 (formerly 2B9), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

SERPINB4 mouse monoclonal antibody, clone OTI2B9 (formerly 2B9)

Applications WB
Reactivities Human
Conjugation Unconjugated

SERPINB4 mouse monoclonal antibody, clone OTI2H8 (formerly 2H8)

Applications WB
Reactivities Human
Conjugation Unconjugated

SERPINB4 mouse monoclonal antibody, clone OTI2H8 (formerly 2H8), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

SERPINB4 mouse monoclonal antibody, clone OTI2H8 (formerly 2H8), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

SERPINB4 mouse monoclonal antibody, clone OTI2H8 (formerly 2H8)

Applications WB
Reactivities Human
Conjugation Unconjugated

SERPINB4 mouse monoclonal antibody, clone OTI3C5 (formerly 3C5)

Applications WB
Reactivities Human
Conjugation Unconjugated

SERPINB4 mouse monoclonal antibody, clone OTI3C5 (formerly 3C5), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

SERPINB4 mouse monoclonal antibody, clone OTI3C5 (formerly 3C5), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

SERPINB4 mouse monoclonal antibody, clone OTI3C5 (formerly 3C5)

Applications WB
Reactivities Human
Conjugation Unconjugated

SERPINB4 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications WB
Reactivities Human
Conjugation Unconjugated

SERPINB4 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

SERPINB4 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

SERPINB4 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications WB
Reactivities Human
Conjugation Unconjugated

SERPINB4 mouse monoclonal antibody, clone OTI4C8 (formerly 4C8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB4 mouse monoclonal antibody, clone OTI4C8 (formerly 4C8)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB4 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)

Applications WB
Reactivities Human
Conjugation Unconjugated

SERPINB4 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1), Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

SERPINB4 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1), HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

SERPINB4 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)

Applications WB
Reactivities Human
Conjugation Unconjugated

SERPINB4 mouse monoclonal antibody, clone OTI4C10 (formerly 4C10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB4 mouse monoclonal antibody, clone OTI4C10 (formerly 4C10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB4 mouse monoclonal antibody, clone UMAB16

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SERPINB4 mouse monoclonal antibody, clone UMAB16

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

SERPINB4 mouse monoclonal antibody, clone UMAB16

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated