Antibodies

Jump to Filters
View as table Download
Heparin Cofactor II (SERPIND1) Rabbit Polyclonal Antibody
TA313999

USD 345.00

In Stock

Rabbit polyclonal Heparin Cofactor II antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Heparin Cofactor II.
Heparin Cofactor II (SERPIND1) Rabbit Polyclonal Antibody
TA332957

USD 275.00

3 Weeks

Rabbit anti-SERPIND1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human SERPIND1
Heparin Cofactor II (SERPIND1) Rabbit Polyclonal Antibody
TA346026

USD 475.00

5 Days

Rabbit Polyclonal Anti-SERPIND1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPIND1 antibody: synthetic peptide directed towards the middle region of human SERPIND1. Synthetic peptide located within the following region: VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQ