Germany
Japan
United Kingdom
China
Rabbit anti-SERPINF1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SERPINF1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SERPINF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SERPINF1 antibody: synthetic peptide directed towards the N terminal of human SERPINF1. Synthetic peptide located within the following region: GALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSN |
Goat Anti-SERPINF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KITGKPIKLTQVEHR, from the internal region of the protein sequence according to NP_002606.3. |
Rabbit polyclonal anti P18 Peptide, Pigment Epithelial-Derived Factor PEDF (40-57)
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SERPINF1 mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Anti-SERPINF1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 243 amino acids of human serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 |
Anti-SERPINF1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 243 amino acids of human serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1 |
PEDF/SERPINF1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PEDF/PEDF/SERPINF1 (NP_002606.3). |
| Modifications | Unmodified |
PEDF/SERPINF1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human PEDF/PEDF/SERPINF1. |
PEDF/SERPINF1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human PEDF/PEDF/SERPINF1. |
SERPINF1 (PEDF) mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SERPINF1 (PEDF) mouse monoclonal antibody, clone OTI1F7 (formerly 1F7), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
USD 420.00
4 Weeks
SERPINF1 (PEDF) mouse monoclonal antibody, clone OTI1F7 (formerly 1F7), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | HRP |
SERPINF1 (PEDF) mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- SERPINF1