Germany
Japan
United Kingdom
China
Antibodies
View as table Download
SERPINH1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SERPINH1 |
Rabbit polyclonal anti-SERPINH1 (Hsp47) antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 407 of human HSP47 |
Rabbit Polyclonal Anti-SERPINH1 Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SERPINH1 antibody: synthetic peptide directed towards the C terminal of human SERPINH1. Synthetic peptide located within the following region: DIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRLKGDKMRDEL |
Mouse monoclonal Hsp47 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SERPINH1 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse SERPINH1 |
SERPINH1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SERPINH1 |
Active filters
Target Symbol
- SERPINH1