Antibodies

View as table Download

Rabbit Polyclonal Anti-SERPINI2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINI2 antibody: synthetic peptide directed towards the middle region of human SERPINI2. Synthetic peptide located within the following region: SSEVYVSQVTQKVFFEINEDGSEAATSTGIHIPVIMSLAQSQFIANHPFL

Rabbit Polyclonal Anti-SERPINI2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINI2 antibody: synthetic peptide directed towards the middle region of human SERPINI2. Synthetic peptide located within the following region: LPRFKVEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVF

Goat Polyclonal Antibody against SERPINI2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KGDWKQKFRKEDTQ, from the internal region of the protein sequence according to NP_006208.1; NP_001012303.1.

Rabbit polyclonal antibody to SERPINI2 (serpin peptidase inhibitor, clade I (pancpin), member 2)

Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 213 of (Uniprot ID#O75830)

SERPINI2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

SERPINI2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 56-405 of human SERPINI2 (NP_006208.1).
Modifications Unmodified