Goat Anti-HYPB / SETD2 (internal region) Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ERDPDKQTQNKE, from the internal region of the protein sequence according to NP_054878.3. |
Goat Anti-HYPB / SETD2 (internal region) Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ERDPDKQTQNKE, from the internal region of the protein sequence according to NP_054878.3. |
Rabbit Polyclonal Anti-SETD2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SETD2 antibody: synthetic peptide directed towards the N terminal of human SETD2. Synthetic peptide located within the following region: SDEDSVRTSSSQRSHDLKFSASIEKERDFKKSSAPLKSEDLGKPSRSKTD |
Carrier-free (BSA/glycerol-free) SETD2 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SETD2 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SETD2 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SETD2 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SETD2 Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SETD2 |
SETD2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SETD2 |
SETD2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 803-1103 of human SETD2 (NP_054878.5). |
Modifications | Unmodified |
SETD2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 803-1103 of human SETD2 (NP_054878.5). |
Modifications | Unmodified |
SETD2 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 803-1103 of human SETD2 (NP_054878.5). |
Modifications | Unmodified |
SETD2 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SETD2 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
SETD2 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SETD2 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SETD2 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SETD2 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
SETD2 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SETD2 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SETD2 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SETD2 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
SETD2 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SETD2 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SETD2 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
SETD2 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
SETD2 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SETD2 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |