Germany
Japan
United Kingdom
China
Goat Anti-HYPB / SETD2 (internal region) Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ERDPDKQTQNKE, from the internal region of the protein sequence according to NP_054878.3. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SETD2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SETD2 antibody: synthetic peptide directed towards the N terminal of human SETD2. Synthetic peptide located within the following region: SDEDSVRTSSSQRSHDLKFSASIEKERDFKKSSAPLKSEDLGKPSRSKTD |
Carrier-free (BSA/glycerol-free) SETD2 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SETD2 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SETD2 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SETD2 Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SETD2 |
SETD2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SETD2 |
SETD2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 803-1103 of human SETD2 (NP_054878.5). |
| Modifications | Unmodified |
SETD2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 803-1103 of human SETD2 (NP_054878.5). |
| Modifications | Unmodified |
SETD2 Rabbit polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 803-1103 of human SETD2 (NP_054878.5). |
| Modifications | Unmodified |
SETD2 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SETD2 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
SETD2 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
SETD2 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SETD2 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SETD2 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
SETD2 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
SETD2 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SETD2 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SETD2 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
SETD2 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
SETD2 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
Active filters
Target Symbol
- SETD2