Antibodies

View as table Download

Rabbit polyclonal Anti-Setd5 Antibody

Applications WB
Reactivities Rat
Immunogen The immunogen for anti-Setd5 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: ETVPTWCPCGLSQDGFLLNCDKCRGMSRGKVIRLHRRKQDNISGGDSSAT

SETD5 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 520-740 of human SETD5 (NP_001073986.1).
Modifications Unmodified