Rabbit polyclonal Anti-Setd5 Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for anti-Setd5 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: ETVPTWCPCGLSQDGFLLNCDKCRGMSRGKVIRLHRRKQDNISGGDSSAT |
SETD5 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 520-740 of human SETD5 (NP_001073986.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China