Goat Polyclonal Antibody against SFRP2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KRWQKGQREFKR, from the C Terminus of the protein sequence according to NP_003004.1. |
Goat Polyclonal Antibody against SFRP2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KRWQKGQREFKR, from the C Terminus of the protein sequence according to NP_003004.1. |
Rabbit polyclonal Anti-SFRP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFRP2 antibody: synthetic peptide directed towards the middle region of human SFRP2. Synthetic peptide located within the following region: DRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKN |
Carrier-free (BSA/glycerol-free) SFRP2 mouse monoclonal antibody, clone OTI6E1 (formerly 6E1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SFRP2 mouse monoclonal antibody, clone OTI6C2 (formerly 6C2)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SFRP2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SFRP2 |
SFRP2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 141-295 of human SFRP2 (NP_003004.1). |
| Modifications | Unmodified |
SFRP2 mouse monoclonal antibody, clone OTI6E1 (formerly 6E1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SFRP2 mouse monoclonal antibody, clone OTI6E1 (formerly 6E1), Biotinylated
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
SFRP2 mouse monoclonal antibody, clone OTI6E1 (formerly 6E1), HRP conjugated
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
SFRP2 mouse monoclonal antibody, clone OTI6E1 (formerly 6E1)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SFRP2 mouse monoclonal antibody, clone OTI6C2 (formerly 6C2)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SFRP2 mouse monoclonal antibody, clone OTI6C2 (formerly 6C2), Biotinylated
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
SFRP2 mouse monoclonal antibody, clone OTI6C2 (formerly 6C2), HRP conjugated
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
SFRP2 mouse monoclonal antibody, clone OTI6C2 (formerly 6C2)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |