Rabbit Polyclonal Anti-SFTPB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFTPB antibody: synthetic peptide directed towards the middle region of human SFTPB. Synthetic peptide located within the following region: PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV |
SFTPB (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 128-158 amino acids from the Central region of Human SFTPB |
SFTPB Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 94-393 of human SFTPB (NP_000533.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China