Germany
Japan
United Kingdom
China
Sftpd (Lectin Domain) mouse monoclonal antibody, clone VIF11, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Rat |
Antibodies
View as table Download
USD 480.00
2 Weeks
Surfactant protein D (SFTPD) mouse monoclonal antibody, clone 2A10, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
USD 690.00
2 Weeks
Sftpd (conformational epitope) mouse monoclonal antibody, clone IIE11, Biotin
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Biotin |
Rabbit Polyclonal Anti-SFTPD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFTPD antibody: synthetic peptide directed towards the middle region of human SFTPD. Synthetic peptide located within the following region: PPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSA |
Sftpd (Lectin Domain) mouse monoclonal antibody, clone VIF11, Biotin
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Biotin |
Anti-SFTPD Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 260-375 amino acids of human surfactant protein D |
SFTPD Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 50-220 of human SFTPD (NP_003010.4). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SFTPD