Antibodies

View as table Download

SGK3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Dog, Gorilla, Hamster, Human, Mouse, Orang-Utan, Rat
Immunogen SGK3 antibody was raised against synthetic 20 amino acid peptide from internal region of human SGK3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Mouse, Rat, Hamster, Panda, Dog, Bat (100%); Monkey, Marmoset, Elephant, Bovine, Horse, Rabbit (95%); Turkey, Chicken, Platypus (90%); Opossum, Lizard (85%).

Rabbit polyclonal Anti-SGK3 Antibody

Applications IHC, WB
Reactivities Human
Immunogen The immunogen for anti-SGK3 antibody: synthetic peptide directed towards the N terminal of human SGK3. Synthetic peptide located within the following region: LYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPH

Rabbit Polyclonal Anti-SGK3 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Immunogen SGK3 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human SGK3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit (100%); Dog, Bat, Elephant, Panda, Horse (94%); Mouse, Rat, Hamster, Pig, Lizard (88%); Bovine, Opossum (82%).

Sgk3 Antibody - C-terminal region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide corresponding to a region of Rat

SGK3 Antibody - N-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse SGK3

SGK3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human SGK3 (NP_037389.4).
Modifications Unmodified