Germany
Japan
United Kingdom
China
Sphingomyelin Synthase 1 (SGMS1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide derived from the Human Sphingomyelin Synthase 1 protein |
Antibodies
View as table Download
Sphingomyelin Synthase 1 (SGMS1) rabbit polyclonal antibody, Purified
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide derived from the mouse sphingomyelin synthase 1 protein |
Rabbit polyclonal Anti-SGMS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SGMS1 antibody: synthetic peptide directed towards the middle region of human SGMS1. Synthetic peptide located within the following region: SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI |
Rabbit polyclonal Anti-Sgms1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Sgms1 antibody is: synthetic peptide directed towards the middle region of Mouse Sgms1. Synthetic peptide located within the following region: LTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMILVGL |
SGMS1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-134 of human SGMS1 (NP_671512.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SGMS1