Antibodies

Jump to Filters
View as table Download
SGPL1 Rabbit Polyclonal Antibody
AP05168PU-N

USD 480.00

5 Days

SGPL1 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen Synthetic peptide derived from the sphingosine 1-phosphate lyase 1 protein.
SGPL1 (N-term) Rabbit Polyclonal Antibody
AP53891PU-N

USD 450.00

2 Weeks

SGPL1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of Human SGPL1.
SGPL1 Rabbit Polyclonal Antibody
TA338200

USD 375.00

5 Days

Rabbit Polyclonal Anti-SGPL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGPL1 antibody is: synthetic peptide directed towards the C-terminal region of Human SGPL1. Synthetic peptide located within the following region: IHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTT
SGPL1 Rabbit Polyclonal Antibody
TA351661

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-SGPL1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SGPL1
SGPL1 Rabbit Polyclonal Antibody
TA367252

USD 380.00

4 Weeks

SGPL1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SGPL1
SGPL1 Rabbit Polyclonal Antibody
TA381450

USD 220.00

3 Weeks

SGPL1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-390 of human SGPL1 (NP_003892.2).
Modifications Unmodified