Antibodies

Jump to Filters
View as table Download
sphingosine 1 phosphate phosphatase 1 (SGPP1) Rabbit Polyclonal Antibody
AP05169PU-N

USD 360.00

5 Days

sphingosine 1 phosphate phosphatase 1 (SGPP1) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide derived from the sphingosine 1-phosphate phosphatase 1 protein.
sphingosine 1 phosphate phosphatase 1 (SGPP1) Rabbit Polyclonal Antibody
TA339564

USD 375.00

5 Days

Rabbit Polyclonal Anti-SGPP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGPP1 antibody: synthetic peptide directed towards the middle region of human SGPP1. Synthetic peptide located within the following region: THKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVT