Germany
Japan
United Kingdom
China
Antibodies
View as table Download
SH2D1A rabbit polyclonal antibody, Purified
| Applications | IP, WB |
| Reactivities | Human |
| Immunogen | Full-length recombinant SAP protein |
Goat Polyclonal Antibody against SH2D1A / SAP
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HKRYFRKIKN, from the internal region of the protein sequence according to NP_002342.1. |
Goat Polyclonal Antibody against SH2D1A/SLAM associated protein
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QYPVEKKSSARSTQ, from the internal region of the protein sequence according to NP_002342.1. |
Rabbit Polyclonal Anti-SH2D1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SH2D1A antibody: synthetic peptide directed towards the C terminal of human SH2D1A. Synthetic peptide located within the following region: YFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCL |
Rabbit Polyclonal Anti-SH2D1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SH2D1A antibody is: synthetic peptide directed towards the middle region of Human SH2D1A. Synthetic peptide located within the following region: YTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYP |
SH2D1A Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- SH2D1A