Germany
Japan
United Kingdom
China
USD 410.00
2 Weeks
Mouse Monoclonal anti-SH3GL1 Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit polyclonal Anti-SH3GL1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SH3GL1 antibody: synthetic peptide directed towards the N terminal of human SH3GL1. Synthetic peptide located within the following region: LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES |
USD 465.00
4 Weeks
USD 465.00
4 Weeks
SH3GL1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SH3GL1 |
SH3GL1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 219-368 of human SH3GL1 (NP_003016.1). |
| Modifications | Unmodified |
USD 379.00
In Stock
SH3GL1 mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
In Stock
USD 379.00
In Stock
SH3GL1 mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
Active filters
Target Symbol
- SH3GL1