Antibodies

Jump to Filters
View as table Download
Sonic Hedgehog (SHH) Mouse Monoclonal Antibody [Clone ID: 5H4]
TA336923

USD 424.00

5 Days

Mouse Monoclonal Sonic Hedgehog/Shh Antibody (5H4)

Applications ELISA, FC, IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA336926

USD 457.00

5 Days

Rabbit Polyclonal Sonic Hedgehog/Shh Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal portion of the human SHH protein (between residues 1-75) [UniProt Q15465]
Sonic Hedgehog (SHH) (N-term) Rabbit Polyclonal Antibody
AP23351PU-N

USD 405.00

2 Weeks

Sonic Hedgehog (SHH) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence near the N-terminal of human SHH
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA334657

USD 375.00

5 Days

Rabbit Polyclonal Anti-SHH Antibody

Applications IHC, WB
Reactivities Chicken, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT
Sonic Hedgehog (SHH) Mouse Monoclonal Antibody [Clone ID: OTI3A2]
CF500040

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SHH mouse monoclonal antibody, clone OTI3A2 (formerly 3A2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Sonic Hedgehog (SHH) Mouse Monoclonal Antibody [Clone ID: OTI10H6]
CF500041

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SHH mouse monoclonal antibody, clone OTI10H6 (formerly 10H6)

Applications IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA323715

USD 345.00

In Stock

Anti-SHH Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 448-462 amino acids of Human sonic hedgehog
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA323716

USD 345.00

In Stock

Anti-SHH Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 448-462 amino acids of Human sonic hedgehog
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA363692

USD 360.00

5 Days

SHH Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SHH
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA381475

USD 220.00

3 Weeks

Sonic Hedgehog (Shh) Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide of human Sonic Hedgehog (Sonic Hedgehog (Shh))
Modifications Unmodified
Shh Rabbit Polyclonal Antibody
TA381476

USD 220.00

3 Weeks

SHH Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of Mouse SHH.
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA381477

USD 220.00

3 Weeks

Sonic Hedgehog (Shh) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human Sonic Hedgehog (Sonic Hedgehog (Shh))
Modifications Unmodified
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA385239

USD 380.00

4 Weeks

Sonic Hedgehog Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthesized peptide derived from human Shh
Sonic Hedgehog (SHH) Mouse Monoclonal Antibody [Clone ID: OTI3A2]
TA500040

USD 379.00

In Stock

Anti-SHH (Sonic Hedgehog) mouse monoclonal antibody, clone OTI3A2 (formerly 3A2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Sonic Hedgehog (SHH) Mouse Monoclonal Antibody [Clone ID: OTI3A2]
TA500040S

USD 159.00

2 Days

Anti-SHH (Sonic Hedgehog) mouse monoclonal antibody, clone OTI3A2 (formerly 3A2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Sonic Hedgehog (SHH) Mouse Monoclonal Antibody [Clone ID: OTI10H6]
TA500041

USD 379.00

In Stock

SHH (Sonic Hedgehog) mouse monoclonal antibody, clone OTI10H6 (formerly 10H6)

Applications IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
Sonic Hedgehog (SHH) Mouse Monoclonal Antibody [Clone ID: OTI10H6]
TA500041S

USD 159.00

2 Days

SHH (Sonic Hedgehog) mouse monoclonal antibody, clone OTI10H6 (formerly 10H6)

Applications IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated