Antibodies

Jump to Filters
View as table Download
SIDT2 Rabbit Polyclonal Antibody
TA345644

USD 475.00

5 Days

Rabbit Polyclonal Anti-SIDT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIDT2 antibody: synthetic peptide directed towards the N terminal of human SIDT2. Synthetic peptide located within the following region: LNKQKGAPLLFVVRQKEAVVSFQVPLILRGMFQRKYLYQKVERTLCQPPT
SIDT2 Rabbit Polyclonal Antibody
TA319914

USD 430.00

In Stock

Rabbit Polyclonal SIDT2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rabbit polyclonal SIDT2 antibody was raised against an 18 amino acid peptide near the amino terminus of human SIDT2.