Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SIGLEC12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIGLEC12 antibody: synthetic peptide directed towards the N terminal of human SIGLEC12. Synthetic peptide located within the following region: DTRESDAGTYVFCVERGNMKWNYKYDQLSVNVTASQDLLSRYRLEVPESV |
SIGLECL1 (SIGLEC12) (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human SIGLEC12 |
Rabbit Polyclonal Anti-SIGLEC12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIGLEC12 antibody: synthetic peptide directed towards the N terminal of human SIGLEC12. Synthetic peptide located within the following region: GRFLLLGDPQTNNCSLSIRDARKGDSGKYYFQVERGSRKWNYIYDKLSVH |
Rabbit Polyclonal Anti-SIGLEC12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIGLEC12 antibody: synthetic peptide directed towards the N terminal of human SIGLEC12. Synthetic peptide located within the following region: LCVSVLCSFSYPQNGWTASDPVHGYWFRAGDHVSRNIPVATNNPARAVQE |
SIGLEC12 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SIGLEC12 |
SIGLEC12 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-210 of human SIGLEC12 (NP_443729.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SIGLEC12