SIGLECL1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SIGLECL1 |
SIGLECL1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SIGLECL1 |
Rabbit Polyclonal Anti-SIGLECL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SIGLECL1 antibody is: synthetic peptide directed towards the C-terminal region of Human SIGLECL1. Synthetic peptide located within the following region: RKKQAKKAAAIRAKKSSKVRASQELEMSLKPEEPGKPVVATFSESRILEK |
SIGLECL1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SIGLECL1 |