Antibodies

View as table Download

SIGLECL1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SIGLECL1

Rabbit Polyclonal Anti-SIGLECL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIGLECL1 antibody is: synthetic peptide directed towards the C-terminal region of Human SIGLECL1. Synthetic peptide located within the following region: RKKQAKKAAAIRAKKSSKVRASQELEMSLKPEEPGKPVVATFSESRILEK

SIGLECL1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SIGLECL1