Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal SIK (Ab-182) antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human SIK around the phosphorylation site of threonine 182 (L-S-TP-W-C). |
Rabbit Polyclonal Anti-SNF1LK Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-SNF1LK antibody: synthetic peptide directed towards the N terminal of human SNF1LK. Synthetic peptide located within the following region: MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTK |
Sik1 Antibody - middle region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
SIK1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SIK1 (NP_775490.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SIK1