Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-SIK3 / QSK antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human QSK. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SIK3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SIK3 Antibody: synthetic peptide directed towards the middle region of human SIK3. Synthetic peptide located within the following region: LHAQQLLKRPRGPSPLVTMTPAVPAVTPVDEESSDGEPDQEAVQSSTYKD |
Rabbit Polyclonal Anti-SIK3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SIK3 Antibody is: synthetic peptide directed towards the C-terminal region of Human SIK3. Synthetic peptide located within the following region: SDAVLSQSSLMGSQQFQDGENEECGASLGGHEHPDLSDGSQHLNSSCYPS |
SIK3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SIK3 |
Active filters
Target Symbol
- SIK3