Antibodies

View as table Download

SIL1 (448-461) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from C-term of human SIL1

Rabbit Polyclonal Anti-SIL1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SIL1 Antibody: synthetic peptide directed towards the N terminal of human SIL1. Synthetic peptide located within the following region: KETKAEEELDAEVLEVFHPTHEWQALQPGQAVPAGSHVRLNLQTGEREAK

SIL1 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the Center region of human SIL1

Goat Polyclonal Antibody against BAP / SIL1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-ELLGSVNSLLKELR, from the C Terminus of the protein sequence according to NP_071909.1.

Rabbit Polyclonal Anti-SIL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SIL1 Antibody: synthetic peptide directed towards the C terminal of human SIL1. Synthetic peptide located within the following region: KLQQYRQVHLLPGLWEQGWCEITAHLLALPEHDAREKVLQTLGVLLTTCR

Carrier-free (BSA/glycerol-free) SIL1 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SIL1 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SIL1 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SIL1 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SIL1 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SIL1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SIL1

SIL1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SIL1

Anti-SIL1 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SIL1 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-SIL1 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-SIL1 mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SIL1 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SIL1 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-SIL1 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-SIL1 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SIL1 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SIL1 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-SIL1 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-SIL1 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SIL1 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SIL1 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-SIL1 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-SIL1 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SIL1 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SIL1 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-SIL1 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-SIL1 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated