Germany
Japan
United Kingdom
China
Goat Anti-SIM2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SDLLYTPSYS, from the internal region of the protein sequence according to NP_005060.1; NP_033664.2. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SIM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIM2 antibody: synthetic peptide directed towards the N terminal of human SIM2. Synthetic peptide located within the following region: MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYL |
SIM2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human SIM2 |
SIM2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SIM2 |
SIM2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 342-525 of human SIM2 (NP_033664.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SIM2