Germany
Japan
United Kingdom
China
Rabbit polyclonal SIRT3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human SIRT3. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SIRT3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIRT3 antibody: A synthesized peptide derived from human SIRT3 |
Rabbit Polyclonal Anti-SIRT3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIRT3 antibody: synthetic peptide directed towards the C terminal of human SIRT3. Synthetic peptide located within the following region: VGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGP |
Rabbit Polyclonal Anti-SIRT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIRT3 antibody: synthetic peptide directed towards the middle region of human SIRT3. Synthetic peptide located within the following region: SGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYP |
Goat Polyclonal Antibody against SIRT3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QRETGKLDGPDK, from the C Terminus of the protein sequence according to NP_036371.1, NP_001017524.1. |
Chicken Polyclonal SIRT3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SIRT3 antibody was raised against a 17 amino acid synthetic peptide near the center of human SIRT3. The immunogen is located within amino acids 180 - 230 of SIRT3. |
Rabbit Polyclonal Anti-SIRT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIRT3 antibody: synthetic peptide directed towards the C terminal of human SIRT3. Synthetic peptide located within the following region: VGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGP |
Anti-SIRT3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 126-382 amino acids of human sirtuin 3 |
SIRT3 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-130 of human SIRT3 (NP_036371.1). |
SIRT3 Rabbit polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human SIRT3 (NP_036371.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SIRT3