Germany
Japan
United Kingdom
China
Rabbit anti-SIRT7 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SIRT7 |
Antibodies
View as table Download
Chicken Polyclonal SIRT7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SIRT7 antibody was raised against a 19 amino acid synthetic peptide near the amino terminus of human SIRT7. |
Rabbit Polyclonal Anti-SIRT7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIRT7 antibody: synthetic peptide directed towards the middle region of human SIRT7. Synthetic peptide located within the following region: GEEGSHSRKSLCRSREEAPPGDRGAPLSSAPILGGWFGRGCTKRTKRKKV |
Rabbit Polyclonal Anti-SIRT7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIRT7 antibody: synthetic peptide directed towards the C terminal of human SIRT7. Synthetic peptide located within the following region: DVMRLLMAELGLEIPAYSRWQDPIFSLATPLRAGEEGSHSRKSLCRSREE |
Rabbit Polyclonal SIRT7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A mixture of synthetic peptides corresponding to amino acids 35-51 and 361-377 of human SIRT7 was used as immunogen. |
Anti-SIRT7 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 90-331 amino acids of human sirtuin 7 |
SIRT7 Antibody - middlel region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse SIRT7 |
Active filters
Target Symbol
- SIRT7