Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-SKP2/p45 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SKP2/p45 Antibody: A synthesized peptide derived from human SKP2/p45 |
Antibodies
View as table Download
Rabbit polyclonal SKP2 Antibody (Center)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SKP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 156-185 amino acids from the Central region of human SKP2. |
Rabbit Polyclonal anti-SKP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SKP2 antibody is: synthetic peptide directed towards the C-terminal region of Human SKP2. Synthetic peptide located within the following region: TLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL |
SKP2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SKP2 |
SKP2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SKP2 |
SKP2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human SKP2 |
SKP2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human SKP2 |
| Modifications | Unmodified |
SKP2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SKP2 (NP_005974.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SKP2