Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SLC12A3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC12A3 Antibody: synthetic peptide directed towards the middle region of human SLC12A3. Synthetic peptide located within the following region: ALIVITLPIGRKGKCPSSLYMAWLETLSQDLRPPVILIRGNQENVLTFYC |
SLC12A3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SLC12A3. |
Anti-NCC (Thiazide sensitive NaCl cotransporter) (Thr53) Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr53 of mouse NCC, conjugated to keyhole limpet hemocyanin (KLH). |
Active filters
Target Symbol
- SLC12A3