SLC16A6 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC16A6 |
SLC16A6 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC16A6 |
Rabbit Polyclonal Anti-SLC16A6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC16A6 Antibody: synthetic peptide directed towards the middle region of human SLC16A6. Synthetic peptide located within the following region: ILKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDQDRAAFLLSTMA |
SLC16A6 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SLC16A6 |
SLC16A6 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC16A6 |