Antibodies

Jump to Filters
View as table Download
SLC17A3 Rabbit Polyclonal Antibody
TA346434

USD 475.00

5 Days

Rabbit Polyclonal Anti-SLC17A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC17A3 antibody: synthetic peptide directed towards the middle region of human SLC17A3. Synthetic peptide located within the following region: FVVIYDDPVSYPWISTSEKEYIISSLKQQVGSSKQPLPIKAMLRSLPIWS
SLC17A3 Rabbit Polyclonal Antibody
TA360344

USD 360.00

5 Days

SLC17A3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SLC17A3