Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-AAAT antibody for SISCAPA, clone OTIR5A7
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SLC1A5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC1A5 antibody: synthetic peptide directed towards the middle region of human SLC1A5. Synthetic peptide located within the following region: FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV |
SLC1A5 / ASCT2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | SLC1A5 / ASCT2 antibody was raised against synthetic 15 amino acid peptide from C-Terminus of human SLC1A5. Percent identity with other species by BLAST analysis: Human (100%); Gibbon, Monkey, Rat (93%); Marmoset, Hamster, Elephant, Horse (87%); Mouse, Bat, Bovine (80%). |
SLC1A5 / ASCT2 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Immunogen | SLC1A5 / ASCT2 antibody was raised against synthetic 15 amino acid peptide from internal region of human SLC1A5. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Marmoset (93%); Pig (80%). |
SLC1A5 / ASCT2 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Gorilla |
| Immunogen | SLC1A5 / ASCT2 antibody was raised against synthetic 17 amino acid peptide from internal region of human SLC1A5. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%). |
SLC1A5 / ASCT2 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Human |
| Conjugation | Unconjugated |
| Immunogen | SLC1A5 / ASCT2 antibody was raised against synthetic 17 amino acid peptide from internal region of human SLC1A5. Percent identity with other species by BLAST analysis: Human, Gibbon, Marmoset (100%); Monkey (94%); Dog, Horse (82%). |
Anti-SLC1A5 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 211-224 amino acids of human solute carrier family 1 (neutral amino acid transporter), member 5 |
SLC1A5 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SLC1A5 |
SLC1A5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC1A5 (NP_005619.1). |
| Modifications | Unmodified |
SLC1A5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 154-224 of human SLC1A5 (NP_005619.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SLC1A5