Rabbit Polyclonal Anti-SLC22A11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC22A11 Antibody: synthetic peptide directed towards the C terminal of human SLC22A11. Synthetic peptide located within the following region: ASSLVVLFFLPETQGLPLPDTIQDLESQKSTAAQGNRQEAVTVESTSL |
Rabbit Polyclonal Anti-SLC22A11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC22A11 Antibody: synthetic peptide directed towards the N terminal of human SLC22A11. Synthetic peptide located within the following region: MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCW |
SLC22A11 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 40-150 of human SLC22A11 (NP_060954.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
