Rabbit Polyclonal Anti-SLC25A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC25A1 Antibody: synthetic peptide directed towards the middle region of human SLC25A1. Synthetic peptide located within the following region: NKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGL |
Rabbit Polyclonal Anti-SLC25A1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SLC25A1 |
SLC25A1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-311 of human SLC25A1 (NP_005975.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China