Rabbit Polyclonal Anti-SLC25A22 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC25A22 Antibody: synthetic peptide directed towards the N terminal of human SLC25A22. Synthetic peptide located within the following region: LQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRS |
Rabbit Polyclonal Anti-SLC25A22 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC25A22 Antibody: synthetic peptide directed towards the N terminal of human SLC25A22. Synthetic peptide located within the following region: VNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIV |
SLC25A22 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 128-188 of human SLC25A22 (NP_078974.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
