Antibodies

Jump to Filters
View as table Download
SLC25A28 Rabbit Polyclonal Antibody
TA333637

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC25A28 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC25A28 Antibody: synthetic peptide directed towards the C terminal of human SLC25A28. Synthetic peptide located within the following region: NTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPST
SLC25A28 Rabbit Polyclonal Antibody
TA333636

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC25A28 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC25A28 Antibody: synthetic peptide directed towards the middle region of human SLC25A28. Synthetic peptide located within the following region: VWQNEGAGAFYRSYTTQLTMNVPFQAIHFMTYEFLQEHFNPQRRYNPSSH