Antibodies

Jump to Filters
View as table Download
SLC26A3 Rabbit Polyclonal Antibody
TA329353

USD 375.00

5 Days

Rabbit Polyclonal anti-SLC26A3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC26A3 antibody: synthetic peptide directed towards the middle region of human SLC26A3. Synthetic peptide located within the following region: DAVLHILMKKDYSTSKFNPSQEKDGKIDFTINTNGGLRNRVYEVPVETKF
SLC26A3 Rabbit Polyclonal Antibody
TA366063

USD 380.00

4 Weeks

SLC26A3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SLC26A3
SLC26A3 Rabbit Polyclonal Antibody
TA370415

USD 380.00

4 Weeks

SLC26A3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SLC26A3