Antibodies

Jump to Filters
View as table Download
SLC26A5 Rabbit Polyclonal Antibody
TA334633

USD 310.00

5 Days

Rabbit Polyclonal Anti-SLC26A5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC26A5 antibody: synthetic peptide directed towards the middle region of human SLC26A5. Synthetic peptide located within the following region: FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRS
SLC26A5 Rabbit Polyclonal Antibody
TA351690

USD 345.00

In Stock

Rabbit Polyclonal Anti-SLC26A5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC26A5
SLC26A5 Rabbit Polyclonal Antibody
TA351691

USD 345.00

In Stock

Rabbit Polyclonal Anti-SLC26A5 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC26A5