Antibodies

Jump to Filters
View as table Download
SLC27A6 Rabbit Polyclonal Antibody
TA319899

USD 430.00

In Stock

Rabbit Polyclonal SLC27A6 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SLC27A6 antibody was raised against a 16 amino acid peptide near the amino terminus of human SLC27A6.
SLC27A6 Rabbit Polyclonal Antibody
TA334139

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC27A6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC27A6 Antibody: synthetic peptide directed towards the middle region of human SLC27A6. Synthetic peptide located within the following region: KSTCLYIFTSGTTGLPKAAVISQLQVLRGSAVLWAFGCTAHDIVYITLPL