Antibodies

View as table Download

SLC29A2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC29A2

Rabbit Polyclonal Anti-SLC29A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen SLC29A2 antibody was raised against a 19 amino acid peptide near the center of human SLC29A2.

Rabbit polyclonal Anti-Equilibrative Nucleoside Transporter 2 (ENT2)

Applications IF, WB
Reactivities Mouse, Rat

Rabbit Polyclonal Anti-SLC29A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC29A2 Antibody: synthetic peptide directed towards the N terminal of human SLC29A2. Synthetic peptide located within the following region: ARILSTNHTGPEDAFNFNNWVTLLSQLPLLLFTLLNSFLYQCVPETVRIL

Rabbit Polyclonal Anti-SLC29A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC29A2 Antibody: synthetic peptide directed towards the C terminal of human SLC29A2. Synthetic peptide located within the following region: PLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLV

SLC29A2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC29A2