Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-SLC30A1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SLC30A1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SLC30A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC30A1 Antibody: synthetic peptide directed towards the middle region of human SLC30A1. Synthetic peptide located within the following region: FCVNPCFPDPCKAFVEIINSTHASVYEAGPCWVLYLDPTLCVVMVCILLY |
SLC30A1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human SLC30A1 (NP_067017.2). |
| Modifications | Unmodified |
SLC30A1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 328-507 of human SLC30A1 (NP_067017.2). |
| Modifications | Unmodified |
SLC30A1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human SLC30A1 (NP_067017.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SLC30A1