Antibodies

Jump to Filters
View as table Download
Zinc transporter 8 (SLC30A8) Rabbit Polyclonal Antibody
TA346518

USD 475.00

In Stock

Rabbit Polyclonal Anti-SLC30A8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC30A8 antibody: synthetic peptide directed towards the middle region of human SLC30A8. Synthetic peptide located within the following region: LLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTG
Zinc transporter 8 (SLC30A8) Rabbit Polyclonal Antibody
TA590368

USD 409.00

In Stock

Rabbit Polyclonal SLC30A8/ZNT8 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody was made against a protein fragment from the N Terminus Region
Zinc transporter 8 (SLC30A8) Rabbit Polyclonal Antibody
TA355018

USD 430.00

5 Days

Rabbit Polyclonal Anti-SLC30A8 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen SLC30A8 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human SLC30A8.