Rabbit Polyclonal Anti-SLC33A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC33A1 Antibody: synthetic peptide directed towards the middle region of human SLC33A1. Synthetic peptide located within the following region: CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG |
Anti-SLC33A1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 240-254 amino acids of human solute carrier family 33 (acetyl-CoA transporter), member 1 |
Anti-SLC33A1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 240-254 amino acids of human solute carrier family 33 (acetyl-CoA transporter), member 1 |
Germany
Japan
United Kingdom
China
